PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g01820.11.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NF-YA
Protein Properties Length: 171aa    MW: 18648.8 Da    PI: 10.4848
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g01820.11.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.87.4e-3364120158
          CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                        +ep+YVNaKQy++Il+RRq+Rak+e+e+kl +k+rkpylheSRh+hAl+R+Rg gGrF
  Bradi4g01820.11.p  64 EEPVYVNAKQYNAILRRRQSRAKAESERKL-IKGRKPYLHESRHQHALKRARGAGGRF 120
                        69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.3E-3562123IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.93463123IPR001289Nuclear transcription factor Y subunit A
PfamPF020455.3E-2765120IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.2E-236688IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068606888IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.2E-2397120IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MKTRGRGCWR PEARGTGKET LEGQIAYPSI DPYFYGAYGG QPMMHPPLVG MHPAGLPLPT  60
DAIEEPVYVN AKQYNAILRR RQSRAKAESE RKLIKGRKPY LHESRHQHAL KRARGAGGRF  120
LNAKSDDNEE HSDSSSKDKQ NGVAPRSSGQ PSTAPSSKGA SPANQTGNRE *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A4e-2263136174NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0096241e-128BT009624.1 Triticum aestivum clone wre1n.pk0143.h2:fis, full insert mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014758866.11e-105PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
RefseqXP_010237028.11e-105PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
RefseqXP_010237027.11e-105PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
SwissprotQ84JP13e-44NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
TrEMBLI1IGH11e-105I1IGH1_BRADI; Uncharacterized protein
STRINGBRADI4G01820.11e-105(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.15e-40nuclear factor Y, subunit A7